X
Email:
sales@ruixibiotech.com

Adrenomedullin (human) trifluoroacetate salt

H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-610 0.5mg 420.00
- +
+ Add to cart
R-M-610 1mg 715.00
- +
+ Add to cart

Product description

Adrenomedullin (human) trifluoroacetate salt,CAS:148498-78-6 from ruixi.Adrenomedullin (ADM) elicits a potent and longlasting hypotensive effect and is considered as a hormone involved in blood pressure control. Additionally, ADM acts as a protective factor of blood vessels. Adrenomedullin is a potent stimulator of osteoblastic activity. Further biological activities of hADM include reduction of oxidative stress and inhibition of endothelial cell apoptosis.


Appearance N/A
Molecular weight N/A
Purity >95%
Solubility N/A
Cas 148498-78-6
Sequence  YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂
Synonyms Adrenomedullin (1-52), human, ADM (1-52) (human)
Molecular Formula  C₂₆₄H₄₀₆N₈₀O₇₇S₃
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product