Adrenomedullin (human) trifluoroacetate salt
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-610 | 0.5mg | 420.00 | + Add to cart |
|
R-M-610 | 1mg | 715.00 | + Add to cart |
|
|
Product description
Adrenomedullin (human) trifluoroacetate salt,CAS:148498-78-6 from ruixi.Adrenomedullin (ADM) elicits a potent and longlasting hypotensive effect and is considered as a hormone involved in blood pressure control. Additionally, ADM acts as a protective factor of blood vessels. Adrenomedullin is a potent stimulator of osteoblastic activity. Further biological activities of hADM include reduction of oxidative stress and inhibition of endothelial cell apoptosis.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 148498-78-6 |
Sequence | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂ |
Synonyms | Adrenomedullin (1-52), human, ADM (1-52) (human) |
Molecular Formula | C₂₆₄H₄₀₆N₈₀O₇₇S₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product